The KPI Tree Builder
Metrics & analytics
metrics & analyticscross-industrytool-agnostickpimetricsanalyticsadvanced
Entry PT-0044 · full textReceived
Our north star metric is [METRIC]. Decompose it into a KPI tree: the three to five input metrics that drive it, what drives each of those one level down, and which team owns each input. Flag the metrics that are vanity (move without mattering) and the one input with the most leverage right now given this context: [PASTE CONTEXT].
Inputs needed
- #North star metric
- #Business context
The receipts
What good output looks like
True driver decomposition (not a metric list), owners assigned, vanity metrics flagged, one leverage point defended.
The stream
Reading the room…
Same drawer
PT-0001
The Positioning Stress Test
Positioning
PT-0254The Weekly Client Status Report
Standardize client status reporting
PT-0279Tighten a Draft With a Skeptical Editor
Rewrite a draft to lead with its boldest claim, remove filler, and replace vague language with specifics.
PT-0278B2B Positioning, Objection Rebuttals & Cold Email Sequence
Turn a product description into positioning, objection rebuttals, and a five-email cold outreach sequence.